PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472119
Common NameARALYDRAFT_472119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 261aa    MW: 29014.1 Da    PI: 6.5085
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472119genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-1262103346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T eE++l+++ ++ +G++ W +Ia++++ g+t++++k +w++
           472119  62 SFTSEEEDLIIKMHAAMGSR-WQLIAQHLP-GKTEEEVKMFWNT 103
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-1342112IPR009057Homeodomain-like
PROSITE profilePS5129417.24555109IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-1757109IPR009057Homeodomain-like
SMARTSM007171.9E-1359107IPR001005SANT/Myb domain
CDDcd001676.63E-1062105No hitNo description
PfamPF002491.7E-1162103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVRSCSSKSK NPWANEEDTA QKFVFASASK NGSAAPKKIG LRRCGKSCRV RKTDHSGTKH  60
ESFTSEEEDL IIKMHAAMGS RWQLIAQHLP GKTEEEVKMF WNTKLKKKLS EMGIDHVTHR  120
PFSHVLAEYG NINGGGNINP NPLNQAGSLG RNHSLNDDAH QQQQPDDSGD LMFHLQAIKL  180
MTESSNQVKP ESTFVYASSS SSNSSPPLFS STCSTIAQEN LEVNFTWSDF LLEQETFHEN  240
QQSHPQELDS LFGNDFSEAA A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-12101097108B-MYB
1gv2_A2e-12101094105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-121010958159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-121010958159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-12101094105C-Myb DNA-Binding Domain
1msf_C2e-12101094105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00148DAPTransfer from AT1G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934660.0AB493466.1 Arabidopsis thaliana At1g18960 mRNA for hypothetical protein, partial cds, clone: RAAt1g18960.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890308.10.0hypothetical protein ARALYDRAFT_472119, partial
TrEMBLD7KH860.0D7KH86_ARALL; Putative uncharacterized protein (Fragment)
STRINGfgenesh2_kg.1__2073__AT1G18960.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148221518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18960.11e-160MYB_related family protein